Hepatitis C virus (HCV, гепатит C), структурные и неструктурные белки, антитела, качественный, кровь. Неструктурные белки вируса гепатита с


Неструктурные белки вируса гепатита с

В ответ на попадание в организм человека инородных частиц, таких, как вирусы, иммунная система вырабатывает иммуноглобулины — защитные антитела. Эти антитела выявляют специальным анализом методом ИФА, скрининговым исследованием, используемым для установления факта инфицирования человека вирусом гепатита С. Для гепатита С все антитела содержат аббревиатуру anti-HCV. что означает «против вируса гепатита С».

Антитела гепатита С бывают двух классов — G и M, что в анализах пишется, как IgG и IgM (Ig – immunoglobulin (иммуноглобулин) — это латинское название антител). Anti-HCV total (anti-НСV, анти-hcv ) — суммарные антитела (классов IgG и IgM) к антигенам вируса гепатита C. Тест на определение этих маркеров проводится всем пациентам, когда хотят проверить, есть ли у них гепатит С. Anti-HCV присутствуют как при остром (они могут обнаруживаться уже с 4 - 6 недели после инфицирования), так и при хроническом гепатите. Anti-HCV tota l также встречаются у тех, кто переболел гепатитом С и выздоровел самостоятельно. У таких людей данный маркер может обнаруживаться в течение 4 - 8 и более лет после выздоровления. Поэтому положительный анализ на anti-HCV не является достаточным для того, чтобы установить диагноз. На фоне хронической инфекции суммарные антитела выявляются постоянно, а после успешного лечения сохраняются длительное время (прежде всего за счет anti-HCV core IgG. о них написано ниже), при этом их титры постепенно снижаются.«

Важно знать, что антитела к гепатиту С не защищают от развития HCV-инфекции и не обеспечивают надежного иммунитета против повторного инфицирования.

Спектр anti-НСV (core, NS3, NS4, NS5) — это специфические антитела к отдельным структурным и неструктурным белкам вируса гепатита С. Их определяют для суждения о вирусной нагрузке, активности инфекции, риске хронизации, разграничении острого и хронического гепатита, степени поражения печени. Обнаружение антител к каждому из антигенов имеет самостоятельное диагностическое значение. Anti-HCV состоят их структурных (core) и неструктурных (NS3. NS4. NS5 ) белков (протеинов).

Anti-HCV core IgG —антитела класса G к ядерным (core) белкам HCV. Anti-HCV IgG появляются с 11-12 недели после инфицирования, поэтому для диагностики возможных «свежих» случаев инфицирования используют Anti-HCV total, которые появляются раньше. Anti-HCV IgG достигают пика концентрации к 5 - 6 месяцу с момента инфицирования и при хроническом течении болезни выявляются в крови пожизненно. При перенесенном гепатите С титр антител класса IgG постепенно снижается и может достигнуть неопределяемых величин через несколько лет после выздоровления.

Anti-HCV IgM —антитела класса IgM к антигенам вируса гепатита C. Anti-HCV IgM могут определяться в крови уже через 4-6 недель после инфицирования, их концентрация быстро достигает максимума. После завершения острого процесса уровень IgM падает и может повышается вновь во время реактивации инфекции, поэтому принято считать, что эти антитела являются признаком острой инфекции или хронической с признаками реактивации. При остром гепатите С длительное обнаружение антител класса М, является фактором, прогнозирующим переход заболевания в хроническую форму. Считается, что обнаружение anti-HCV IgM может отражать уровень виремии и активность гепатита С, однако не всегда при реактивации ХВГС anti-HCV IgM выявляются. Также есть случаи, когда при хроническом гепатите С в отсутствии реактивации обнаруживаются anti-HCV IgM .

В большинстве случаев, наличие anti-HCV IgM указывает на текущую инфекцию. При хроническом гепатите С антитела класса М могут свидетельствовать об обострении процесса. При проведении терапии интерфероном наблюдение за anti-HCV IgM в динамике позволяет оценивать эффективность лечения.

Неструктурные (NS3, NS4, NS5) белки.

NS3, NS4, NS5 относятся к неструктурным (NS — nonstructural ) белкам. На самом деле, этих белков больше — NS2, NS3, NS4a, NS4b, NS5a, NS5b, однако в большинстве клинико-диагностических лабораторий определяют антитела к белкам NS3, NS4 и NS5.

Anti-NS3 выявляются на самых ранних этапах сероконверсии. Высокие титры anti-NS3 характерны при остром гепатите С и могут являться самостоятельным диагностическим маркером острого процесса. При остром процессе высокая концентрация anti-NS3 обычно свидетельствует о значительной вирусной нагрузке, а длительное сохранение их в острой фазе связано с высоким риском хронизации инфекционного процесса.

Anti -NS4 и anti-NS5, как правило, появляются в более поздние сроки. При ХВГС определение anti-NS4 в высоких титрах может свидетельствовать о длительности инфекционного процесса и, по некоторым данным, имеет связь со степенью поражения печени. Выявление anti-NS5 в высоких титрах часто свидетельствует о присутствии вирусной РНК, а в острой стадии является предиктором хронизации инфекционного процесса. Снижение титров NS4 и NS5 в динамике может являться благоприятным признаком, указывающим на формирование клинико-биохимической ремиссии. Титры anti-NS5 могут отражать эффективность ПВТ, причем их повышенные значения характерны для лиц, не отвечающих на терапию. После выздоровления титры anti-NS4 и anti-NS5 снижаются с течением времени. Результаты одного из исследований показали, что почти у половины пациентов через 10 лет после успешного лечения интерферонами, anti-NS4 и anti-NS5 не определялись. В следующей таблице приведены наиболее вероятные варианты трактовки сочетания маркеров гепатита С.

В ответ на попадание в организм человека инородных частиц, таких, как вирусы, иммунная система вырабатывает иммуноглобулины защитные антитела. Эти антитела выявляют специальным анализом методом ИФА, скрининговым исследованием, используемым для установления факта инфицирования человека вирусом гепатита С. Для гепатита С все антитела содержат аббревиатуру anti-HCV, что означает против вируса гепатита С.

Антитела гепатита С бывают двух классов G и M, что в анализах пишется, как IgG и IgM (Ig immunoglobulin (иммуноглобулин) это латинское название антител). Anti-HCV total (anti-НСV, анти-hcv) суммарные антитела (классов IgG и IgM) к антигенам вируса гепатита C. Тест на определение этих маркеров проводится всем пациентам, когда хотят проверить, есть ли у них гепатит С. Anti-HCV присутствуют как при остром (они могут обнаруживаться уже с 4 - 6 недели после инфицирования), так и при хроническом гепатите. Anti-HCV total также встречаются у тех, кто переболел гепатитом С и выздоровел самостоятельно. У таких людей данный маркер может обнаруживаться в течение 4 - 8 и более лет после выздоровления.

Поэтому положительный анализ на anti-HCV не является достаточным для того, чтобы установить диагноз. На фоне хронической инфекции суммарные антитела выявляются постоянно, а после успешного лечения сохраняются длительное время (прежде всего за счет anti-HCV core IgG, о них написано ниже), при этом их титры постепенно снижаются.

Спектр anti-НСV (core, NS3, NS4, NS5) это специфические антитела к отдельным структурным и неструктурным белкам вируса гепатита С. Их определяют для суждения о вирусной нагрузке, активности инфекции, риске хронизации, разграничении острого и хронического гепатита, степени поражения печени. Обнаружение антител к каждому из антигенов имеет самостоятельное диагностическое значение. Anti-HCV состоят их структурных (core) и неструктурных (NS3, NS4, NS5) белков (протеинов).

Anti-HCV core IgG антитела класса G к ядерным (core) белкам HCV. Anti-HCV IgG появляются с 11-12 недели после инфицирования, поэтому для диагностики возможных свежих случаев инфицирования используют Anti-HCV total, которые появляются раньше. Anti-HCV IgG достигают пика концентрации к 5 - 6 месяцу с момента инфицирования и при хроническом течении болезни выявляются в крови пожизненно. При перенесенном гепатите С титр антител класса IgG постепенно снижается и может достигнуть неопределяемых величин через несколько лет после выздоровления.

Неструктурные (NS3, NS4, NS5) белки.

NS3, NS4, NS5 относятся к неструктурным (NS nonstructural) белкам. На самом деле, этих белков больше NS2, NS3, NS4a, NS4b, NS5a, NS5b, однако в большинстве клинико-диагностических лабораторий определяют антитела к белкам NS3, NS4 и NS5.

Anti-NS3 выявляются на самых ранних этапах сероконверсии. Высокие титры anti-NS3 характерны при остром гепатите С и могут являться самостоятельным диагностическим маркером острого процесса. При остром процессе высокая концентрация anti-NS3 обычно свидетельствует о значительной вирусной нагрузке, а длительное сохранение их в острой фазе связано с высоким риском хронизации инфекционного процесса.

Anti -NS4 и anti-NS5, как правило, появляются в более поздние сроки. При ХВГС определение anti-NS4 в высоких титрах может свидетельствовать о длительности инфекционного процесса и, по некоторым данным, имеет связь со степенью поражения печени. Выявление anti-NS5 в высоких титрах часто свидетельствует о присутствии вирусной РНК, а в острой стадии является предиктором хронизации инфекционного процесса. Снижение титров NS4 и NS5 в динамике может являться благоприятным признаком, указывающим на формирование клинико-биохимической ремиссии. Титры anti-NS5 могут отражать эффективность ПВТ, причем их повышенные значения характерны для лиц, не отвечающих на терапию. После выздоровления титры anti-NS4 и anti-NS5 снижаются с течением времени. Результаты одного из исследований показали, что почти у половины пациентов через 10 лет после успешного лечения интерферонами, anti-NS4 и anti-NS5 не определялись. В следующей таблице приведены наиболее вероятные варианты трактовки сочетания маркеров гепатита С.

Подготовка пациента: Сдача крови натощак.

Стабильность пробы: не более 3 суток при температуре 2-8 C при условии отсутствия микробной контаминации и не более 3 месяцев при температуре -20 C. Замораживать не более одного раза.

Анализатор: Sinnowa ER-500.

Тест система: VitroTest.

Референсные значения (норма):

Антитела к вирусу гепатита С

Когда происходит заражение, продуцируются антитела к вирусу гепатита С. Подобное явление говорит о том, что организм старается справиться с возбудителем. Когда анализы показали наличие антител, то есть иммуноглобулинов, то у любого человека сразу возникнет беспокойство по поводу дальнейшего развития ситуации. Врачи советуют преждевременно не паниковать, потому что с помощью одного анализа окончательный диагноз не ставится. Тем более есть факторы, которые могут результаты искажать.

Характеристика иммуноглобулинов

От инфекционного недуга не застрахован ни один человек. В большинстве случаев болезнь развивается при отсутствии симптоматики. Но как только чужеродные элементы попадают в организм, включаются защитные силы. Другими словами, вырабатываются антитела к гепатиту С. Они не дают вредоносному вирусу в крови дальше распространяться.

Поскольку существует несколько генотипов возбудителя, то бороться с ними будут антитела разных видов гепатита С.

Речь идет об иммуноглобулинах:

Суммарные иммуноглобулины образовываются в крови в разное время.

  • На протяжении первых полутора месяцев в крови быстро увеличивается количество IgM. Это значит, что болезненный процесс обостряется, из-за чего появляются антитела к вирусу гепатита С. Несколько месяцев заболевание протекает скрытно. После того как наступил пик концентрации иммуноглобулинов, их количество в крови начинает уменьшаться. Далее, наблюдается развитие следующего этапа.
  • Антитела против инфекции при гепатите С, которые имеют название IgG, появятся спустя 3 месяца с момента инфицирования. Однако суммарные показатели иммуноглобулинов группы G бывают обнаружены и месяца через два. Существует норма концентрации IgG в крови. Если анализ демонстрирует, что она присутствует, это свидетельствует об окончании острой фазы. Но при этом следует быть готовым к появлению хронической формы либо к тому, что больной станет вирусоносителем.

Следует сказать, что возбудителем воспроизводятся структурные и неструктурные белки.

Наличие в крови определенного вида белка, в частности структурного core-антигена, вызывает ответную реакцию – появляются антитела конкретного вида при гепатите С.

Если иммуноглобулины обнаружены в чрезмерном количестве, значит, имеется много неструктурных белков.

Особенности течения заболевания

Болезнь протекает волнообразно.

Фаз при этом существует три:

  1. Латентная. Никакие выраженные клинические проявления того, что инфекция в крови присутствует, не наблюдаются. Но, с другой стороны, анализ покажет наличие иммуноглобулинов группы G к белку core и к другим белкам – неструктурным. Титр антител к вирусу высокий. Отличие фазы в том, что не обнаруживаются маркеры IgM и РНК возбудителя. Правда, их концентрация все же может быть, хотя и незначительной. Такое происходит, если болезнь обостряется.
  2. Острая. В сыворотке крови становится больше печеночных ферментов. Антитела IgM и IgG при гепатите С присутствуют, при этом отмечается нарастание их титров. Кроме того, имеются антитела к РНК возбудителя гепатита С.
  3. Фаза реактивации (восстановления). Отличается специфическими проявлениями. Активность печеночных ферментов повышается. Наблюдаются высокие титры IgG и РНК вируса. Позже будет обнаружено постепенное увеличение количества IgM.

Данный вид заболевания опасен тем, что он непредсказуем. Поэтому возникает необходимость в определенных исследованиях, которые помогут изучить происходящий процесс.

В лабораторных условиях проводится иммуноферментный анализ (ИФА), а также применяется ПЦР – полимеразная цепная реакция.

Способы, позволяющие выявить вирус

Если болезнь находится в стадии обострения, антитела опасного гепатита С обнаруживаются с трудом. Врачи в своей практике пользуются методом непрямого и прямого исследования.

  • Непрямой способ. С его помощью устанавливается инфицирование и насколько сильной является защитная реакция иммунной системы. Определяется, на какой стадии недуг находится, и когда именно вирус проник в клетки. Если у больного иммунная деятельность понижена, то есть диагностировано наличие ВИЧ или почечной дисфункции, расшифровка покажет ответ ложноотрицательный. Наличие ревматоидных проявлений и пассивная передача антител дает значение ложноположительное.

Если результаты анализа положительные, они все равно должны быть перепроверены. Если исследуются серологические маркеры, и расшифровка демонстрирует ответ негативный, а инфекция присутствует, тогда исследование должно быть продолжено с помощью молекулярного определения РНК вируса. Анализ может выявить его спустя пять дней после инфицирования.

  • Метод прямой. Для обнаружения РНК возбудителя в сыворотке крови используется ПЦР. Такой анализ позволяет идентифицировать генотип, а также стадию адсорбции. Расшифровка производится в ранние сроки.

Как уже было сказано, у возбудителя имеется положительно заряженная РНК. Она занимается кодированием 3 структурных белков (среди них core-антиген) и 5 неструктурных. К каждому белку формируются соответствующие иммуноглобулины.

Анализ крови дает возможность обнаружить их и узнать, есть ли инфекция в организме. Расшифровка анализа даст ответ, насколько болезнь успела распространиться. Это покажет количество иммуноглобулинов.

Методика иммуноферментного анализа помогает выявить маркеры, то есть антитела к недугу. Если человек стал вирусоносителем хронической формы, то наблюдаются высокие титры иммуноглобулинов. Если их концентрация снижается, значит, лечение проходит успешно.

Окончательно диагностировать заболевание с помощью ИФА нельзя. Одного этого анализа будет недостаточно. Должны быть и другие лабораторные исследования.

Немного стоит сказать об обнаружении белка core. Его присутствие в крови говорит о случившемся заражении. С момента инфицирования может пройти несколько дней, и уже тогда core-антиген выявляется.

При этом маркеры (антитела) отсутствуют. Другими словами, даже на ранней стадии есть возможность с помощью анализа получить подтверждение заражения. Для определения core-антигена используются комбинированные наборы реагентов. Результат анализа может быть как отрицательным, так и положительным.

Правильный диагноз устанавливается только благодаря тщательному обследованию. Поэтому стоит сохранять максимум спокойствия до получения результатов.

Источники: http://www.hv-info.ru/gepatit-s/analizy/antitela.html, http://newdiagnostics.ua/index.php?Itemid=275id=275option=com_contentview=article, http://pechen1.ru/gepatit/c/antitela-k-gepatitu.html

Комментариев пока нет!

www.dolgojiteli.ru

Структурные белки вируса гепатита с. Вирусные гепатиты. LuchshijLekar.ru

Белки и антигены вируса гепатита С. Диагностика ВГС

Сегодня известно минимум 10 структурных и неструктурных белков. кодируемых геномом HCV. К структурным белкам относят core, envelop 1 и envelop 2. Белок core является белком нуклеокапсида, тогда как envelop 1 и envelop 2 — гликопротеины внешней оболочки вируса. В структурной зоне кодируется также белок р7, функция которого не ясна, однако аналогия с другими представителями семейства Flaviviridae позволяет предположить, что его функция связана с высвобождением вириона из инфицированной клетки. Этот белок отщепляется клеточной пептидазой от envelop 2, но не во всех случаях, что обусловливает существование envelop 2 в виде двух форм более и менее протяженной.

Неструктурная область генома HCV кодирует 6 белков — NS2, NS3, NS4A, NS4B, NS5A и NS5B. Белок NS2 является вирусной металлозависимой протеиназой. Белок NS4A действует как эффектор или кофактор для NSЗ-протеолитической активности в NS4A/NS4B, NS4B/NS5A, NS5A/NS5B сайтах нарезания полипротеина вируса.

В настоящее время фрагменты структурных и неструктурных белков, полученных генноинженерным путем (рекомбинантные белки) или с помощью химического синтеза, используют в качестве антигенов при конструировании иммуноферментных тест-систем. Первое поколение иммуноферментных тест-систем появилось на рынке в 1989 году и было основано на прямом ИФА. В качестве иммуносорбента были использованы фрагменты двух белков, NS3 и NS4, обозначаемых как 5-1-1 и С100-3.

Одновременно были разработаны и подтверждающие тесты на основе иммуноблота с рекомбинантными белками (RIBA). Чувствительность этих тест-систем первого поколения составляла только 64% для ИФА и 55% для иммуноблота. Тест-системы второго поколения появились на рынке в 1991 году. В качестве антигенов, сорбированных на твердой фазе, в этих тест-системах использовали капсидные белки (фрагмент с22-3) и антигены неструктурных регионов NS3 (фрагменты с200 и сЗЗс) и NS4, что позволило повысить чувствительность и специфичность исследований. Поскольку гуморальный иммунный ответ на капсидные антигены (структурные белки) нагинается быстрее, гем на неструктурные белки, период от инфицирования до выявляемой сероконверсии удалось уменьшить до двух месяцев.

Подтверждающие тест-системы на основе иммуноблота позволяли идентифицировать участвующие в реакции антигены. Результаты, полученные при помощи этих тест-систем, интерпретировали как положительные лишь при реакции антител, находящихся в исследуемом субстрате, по крайней мере, с двумя антигенами, тогда как при наличии реакции лишь с одним из антигенов результат считали неопределенным. Было установлено, что специфичность второго поколения тест-систем зависела от источника антигенов. В 1993 году на рынке появилось третье поколение тест-систем. В дополнение к вышеупомянутым антигенам в этих тест-системах используются также антигены, аминокислотная последовательность которых соответствует иммунодоминантным участкам NS5 белков.

В тест-системах первого, второго и третьего поколений в качестве антигенов использовались или рекомбинантные, или синтетические пептиды. В настоящее время можно выделить также тест-системы четвертого поколения, в которых в качестве иммуносорбента используют сочетания рекомбинантных и синтетических пептидов.

Опыт применения тест-систем различных поколений в мире очень большой. Было установлено, что если с помощью тест-систем первого или второго поколения у больных с острым вирусным гепатитом С антитела выявляли на 10-16, а в ряде случаев и 25-30 неделе от начала заболевания, то диагностикумы третьего поколения позволяли сократить этот срок до 2-3 недель. Согласно обобщенным данным чувствительность тест-систем первого, второго и третьего поколений составляет соответственно 70-80%, 92-95% и 97%.

В то же время, по данным С. Colin, 2001, чувствительность тест-систем третьего поколения составила 98,9% у пациентов с хроническими заболеваниями печени и 97,2% на специальных контрольных панелях сывороток. Достижение высокой чувствительности иммуноферментных тест-систем 3 и 4 поколения сопряжено с некоторыми проблемами в обеспечении специфичности исследований, что в ряде случаев может приводить к появлению ложноположительных результатов. В литературе имеются данные о возможных погрешностях в специфичности ELISA 3 тест-систем. Они являются общими для всех ELISA тест-систем, включая тест-системы для диагностики СПИДа.

Ложнопозитивные результаты могут быть следствием повышенного содержания в образцах гамма-глобулинов (сыворотки пациентов африканской расы, миеломная болезнь, ревматоидные факторы), заболеваний печени (цирроз, рак), аутоиммунных заболеваний (коллагенозы, аутоиммунные гепатиты), других вирусных инфекций (ВИЧ, гепатит В) и длительного хранения сывороток в меняющихся температурных условиях. Проведение какой-либо иммунизации также может сопровождаться повышением частоты ложнопозитивных реакций. Рекомендуемые в настоящее время меры по устранению этой проблемы следующие: а) повторная постановка образца в этой же ИФТС; б) повторная детекция anti-HCV в другой ИФТС; в) использование подтверждающих тестов на основе ИФА и иммуноблота.

Однако использование предлагаемых способов подтверждения результатов зачастую приводят к расхождениям в их итоговой трактовке, что показано исследованиями российских и зарубежных исследователей.

В настоящее время производители ИФТС для детекции anti-HCV достигают высокой чувствительности или за счет более полного выявления антител к NS3 или антител к антигенам core. Сравнительные исследования, выполненные на различных группах риска и специальных контрольных панелях показали, что тест-системы, лучше выявлявшие антитела к NS3, оказались несколько более чувствительными, чем тест-системы, лучше выявлявшие антитела к антигенам core. Их чувствительность составляла, соответственно 99,9% и 98,6%.

Hepatitis C virus (HCV, гепатит C), структурные и неструктурные белки, антитела, качественный, кровь

Подготовка к исследованию: Исключение курения за 30 минут до забора крови Исследуемый материал: Взятие крови Как сдавать анализ крови без боли?

Гепатит С - инфекционное заболевание, вызванное РНК вирусом гепатита С. Существует шесть генотипов вируса гепатита С, которые разделены на подтипы.Гепатит С характеризуется воспалением и повреждением печени. Инфекция гепатита С часто протекает безсимптомно, но хроническое течение заболевания может привести к циррозу печени. В некоторых случаях возможно развитие рака печени и опасного для жизни варикозного расширения вен пищевода и желудка.

Около 150-200 миллионов человек заражены гепатитом С. Гепатит С - причина 27% случаев цирроза печени и 25% случаев гепатоцеллюлярной карциномы (рака печени).

Основной путь передачи инфекции в развитых странах - внутривенное употребление наркотиков. В развивающихся странах вирус передается чаще при переливании крови и медицинских процедурах, а также при татуаже. В 20% случаев причина заражения остается невыясненной. Возможные пути передачи гепатита С - пересадка органов и костного мозга, вертикальный путь - от матери ребенку во время родов. В редких случаях гепатит С может передаваться при незащищенных половых контактах, а также совместном использовании средств личной гигиены (бритва, зубная щетка).

Гепатит С сопровождается острой симптоматикой лишь в 15% случаев. Проявления, как правило, мягкие - снижение веса, потеря аппетита, тошнота, мышечные боли, боли в суставах, усталость. У приблизительно 85% инфицированных заболевание переходит в хроническую форму. Обычно хронический гепатит С протекает без клинических проявлений в течение первых десяти лет. Жировые изменения в печени наблюдаются примерно у 50% больных и определяются перед развитием цирроза.

Распространенность гепатита С у иммунокомпрометированных лиц гораздо выше, чем у здоровых людей. Гепатит С у ВИЧ-инфицированных, реципиентов органов, а также при гипогаммаглобулинемии (снижении уровня иммуноглобулинов) отличается быстрым течением и переходом в цирроз печени.

Предполагается, что 5-50% инфицированных вирусом гепатита С не знают о своем статусе. Тестирование рекомендовано группам риска - лицам, употребляющим внутривенные наркотики, а также реципиентам крови (обязательно в случае гемотрансфузии, проведенной до 1992 года,) и лицам, имеющим татуировки. Скрининг также рекомендован при повышении уровня печеночных трансаминаз.

При инфицировании вирусом гепатита С синтезируются антитела к нескольким антигенам вируса. Через 6-8 недель после инфицирования вырабатываются иммуноглобулины к структурным белкам вируса гепатита С, к которым относится сердцевинный core-антиген. Позже, в течение нескольких недель после выработки первых антител, в крови появляются антитела к неструктурным белкам - NS2, NS3, NS4, NS5. Выявление антител сразу к нескольким антигенам вируса гепатита С повышает диагностическую ценность метода.

Данный анализ позволяет выявить антитела к структурным и неструктурным белкам вируса гепатита С. Анализ помогает диагностировать гепатит С.

Метод

Иммуно-ферментный анализа - ИФА

В ответ на попадание в организм человека инородных частиц, таких, как вирусы, иммунная система вырабатывает иммуноглобулины — защитные антитела. Эти антитела выявляют специальным анализом методом ИФА, скрининговым исследованием, используемым для установления факта инфицирования человека вирусом гепатита С. Для гепатита С все антитела содержат аббревиатуру anti-HCV, что означает против вируса гепатита С .

Антитела гепатита С бывают двух классов — G и M, что в анализах пишется, как IgG и IgM (Ig –immunoglobulin (иммуноглобулин) — это латинское название антител). Anti-HCV total (anti-НСV, анти-hcv) — суммарные антитела (классов IgG и IgM) к антигенам вируса гепатита C. Тест на определение этих маркеров проводится всем пациентам, когда хотят проверить, есть ли у них гепатит С. Anti-HCV присутствуют как при остром (они могут обнаруживаться уже с 4 - 6 недели после инфицирования), так и при хроническом гепатите. Anti-HCV total также встречаются у тех, кто переболел гепатитом С и выздоровел самостоятельно. У таких людей данный маркер может обнаруживаться в течение 4 - 8 и более лет после выздоровления.

Поэтому положительный анализ на anti-HCV не является достаточным для того, чтобы установить диагноз. На фоне хронической инфекции суммарные антитела выявляются постоянно, а после успешного лечения сохраняются длительное время (прежде всего за счет anti-HCV core IgG, о них написано ниже), при этом их титры постепенно снижаются.

Спектр anti-НСV (core, NS3, NS4, NS5) — это специфические антитела к отдельным структурным и неструктурным белкам вируса гепатита С. Их определяют для суждения о вирусной нагрузке, активности инфекции, риске хронизации, разграничении острого и хронического гепатита, степени поражения печени. Обнаружение антител к каждому из антигенов имеет самостоятельное диагностическое значение. Anti-HCV состоят их структурных (core) и неструктурных (NS3, NS4, NS5) белков (протеинов).

Anti-HCV core IgG —антитела класса G к ядерным (core) белкам HCV. Anti-HCV IgG появляются с 11-12 недели после инфицирования, поэтому для диагностики возможных свежих случаев инфицирования используют Anti-HCV total, которые появляются раньше. Anti-HCV IgG достигают пика концентрации к 5 - 6 месяцу с момента инфицирования и при хроническом течении болезни выявляются в крови пожизненно. При перенесенном гепатите С титр антител класса IgG постепенно снижается и может достигнуть неопределяемых величин через несколько лет после выздоровления.

Неструктурные (NS3, NS4, NS5) белки.

NS3, NS4, NS5 относятся к неструктурным (NS — nonstructural) белкам. На самом деле, этих белков больше — NS2, NS3, NS4a, NS4b, NS5a, NS5b, однако в большинстве клинико-диагностических лабораторий определяют антитела к белкам NS3, NS4 и NS5.

Anti-NS3 выявляются на самых ранних этапах сероконверсии. Высокие титры anti-NS3 характерны при остром гепатите С и могут являться самостоятельным диагностическим маркером острого процесса. При остром процессе высокая концентрация anti-NS3 обычно свидетельствует о значительной вирусной нагрузке, а длительное сохранение их в острой фазе связано с высоким риском хронизации инфекционного процесса.

Anti -NS4 и anti-NS5, как правило, появляются в более поздние сроки. При ХВГС определение anti-NS4 в высоких титрах может свидетельствовать о длительности инфекционного процесса и, по некоторым данным, имеет связь со степенью поражения печени. Выявление anti-NS5 в высоких титрах часто свидетельствует о присутствии вирусной РНК, а в острой стадии является предиктором хронизации инфекционного процесса. Снижение титров NS4 и NS5 в динамике может являться благоприятным признаком, указывающим на формирование клинико-биохимической ремиссии. Титры anti-NS5 могут отражать эффективность ПВТ, причем их повышенные значения характерны для лиц, не отвечающих на терапию. После выздоровления титры anti-NS4 и anti-NS5 снижаются с течением времени. Результаты одного из исследований показали, что почти у половины пациентов через 10 лет после успешного лечения интерферонами, anti-NS4 и anti-NS5 не определялись. В следующей таблице приведены наиболее вероятные варианты трактовки сочетания маркеров гепатита С.

Подготовка пациента: Сдача крови натощак.

Стабильность пробы: не более 3 суток при температуре 2-8 C при условии отсутствия микробной контаминации и не более 3 месяцев при температуре -20 C. Замораживать не более одного раза.

Анализатор: Sinnowa ER-500.

Тест – система: VitroTest.

Референсные значения (норма):

Источники: http://meduniver.com/Medical/zabolevania_pecheni/belki_i_antigeni_virusa_gepatita_c.html, http://www.analizmarket.ru/tests/id/4536, http://newdiagnostics.ua/index.php?Itemid=275id=275option=com_contentview=article

Комментариев пока нет!

www.luchshijlekar.ru

Hepatitis C virus (HCV, гепатит C), структурные и неструктурные белки, антитела, качественный, кровь

Подготовка к исследованию: Исключение курения за 30 минут до забора крови Исследуемый материал: Взятие крови

Гепатит С - инфекционное заболевание, вызванное РНК вирусом гепатита С. Существует шесть генотипов вируса гепатита С, которые разделены на подтипы.Гепатит С характеризуется воспалением и повреждением печени. Инфекция гепатита С часто протекает безсимптомно, но хроническое течение заболевания может привести к циррозу печени. В некоторых случаях возможно развитие рака печени и опасного для жизни варикозного расширения вен пищевода и желудка.

Около 150-200 миллионов человек заражены гепатитом С. Гепатит С - причина 27% случаев цирроза печени и 25% случаев гепатоцеллюлярной карциномы (рака печени).

Основной путь передачи инфекции в развитых странах - внутривенное употребление наркотиков. В развивающихся странах вирус передается чаще при переливании крови и медицинских процедурах, а также при татуаже. В 20% случаев причина заражения остается невыясненной. Возможные пути передачи гепатита С - пересадка органов и костного мозга, вертикальный путь - от матери ребенку во время родов. В редких случаях гепатит С может передаваться при незащищенных половых контактах, а также совместном использовании средств личной гигиены (бритва, зубная щетка).

Гепатит С сопровождается острой симптоматикой лишь в 15% случаев. Проявления, как правило, мягкие - снижение веса, потеря аппетита, тошнота, мышечные боли, боли в суставах, усталость. У приблизительно 85% инфицированных заболевание переходит в хроническую форму. Обычно хронический гепатит С протекает без клинических проявлений в течение первых десяти лет. Жировые изменения в печени наблюдаются примерно у 50% больных и определяются перед развитием цирроза.

Распространенность гепатита С у иммунокомпрометированных лиц гораздо выше, чем у здоровых людей. Гепатит С у ВИЧ-инфицированных, реципиентов органов, а также при гипогаммаглобулинемии (снижении уровня иммуноглобулинов) отличается быстрым течением и переходом в цирроз печени.

Предполагается, что 5-50% инфицированных вирусом гепатита С не знают о своем статусе. Тестирование рекомендовано группам риска - лицам, употребляющим внутривенные наркотики, а также реципиентам крови (обязательно в случае гемотрансфузии, проведенной до 1992 года,) и лицам, имеющим татуировки. Скрининг также рекомендован при повышении уровня печеночных трансаминаз.

При инфицировании вирусом гепатита С синтезируются антитела к нескольким антигенам вируса. Через 6-8 недель после инфицирования вырабатываются иммуноглобулины к структурным белкам вируса гепатита С, к которым относится сердцевинный core-антиген. Позже, в течение нескольких недель после выработки первых антител, в крови появляются антитела к неструктурным белкам - NS2, NS3, NS4, NS5. Выявление антител сразу к нескольким антигенам вируса гепатита С повышает диагностическую ценность метода.

Данный анализ позволяет выявить антитела к структурным и неструктурным белкам вируса гепатита С. Анализ помогает диагностировать гепатит С.

www.analizmarket.ru

Структурный и неструктурный белок вируса гепатита с

Гепатит С - инфекция, вызываемая вирусом гепатита С (HCV). Раньше эту инфекцию обозначали как “гепатит ни - А, ни - В, передающийся парентерально”. Вирус HCV является РНК - содержащим вирусом семейства флавивирусов.

Морфология.

HCV - оболочечный вирус со средним размером вириона 35 - 50 нм. Геном образует однонитевая позитивная РНК. Различные гены кодируют структурные (капсидный, мембранный и оболочечный) и неструктурные белки.

К настоящему времени идентифицировано от 6 до 11 генотипов и более 80 подтипов HCV (Львов Д.К., Дерябин П.Г.,1997). Степень гомологии генотипов - порядка 65%, подтипов - 77 - 79%. Различия в генотипе определяют тяжесть заболевания, ответную реакцию на лечение, взаимодействие вируса с хозяином.

Клинико - эпидемиологические особенности.

Эпидемиология вирусного гепатита С напоминает эпидемиологию гепатита В. Несмотря на относительно легкое течение, около половины случаев приводит к хроническим гепатитам, в ряде случаев заканчивающихся циррозом и карциномой печени. Вирус более редко (по сравнению с HBV) передается вертикально и половым путем, преобладает парантеральное заражение (особо - наркоманы). Показана общность групп риска инфицирования HBV и HCV. Выявлены географически преобладающие варианты (генотипы) HCV. В Европейской части России преобладает “западный” генотип, в Азиатской части - “восточный” (близкий к китайскому и японскому).

Лабораторная диагностика.

В настоящее время лабораторная диагностика вирусного гепатита С основана на определении сывороточных маркеров инфицирования - антител суммарных (анти - HCV) и анти - HCV IgM, а также детекции РНК HCV.

Во все тест - системы, начиная с тест - систем “второго поколения” включены аминокислотные последовательности структурного сердцевинного нуклеокапсидного белка (HCc Ag). Антитела к HCc Ag являются самими ранними маркерами инфицирования HCV. С целью повышения эффективности и специфичности ИФА применяют подтверждающие тесты - рекомбинантный иммуноблоттинг или вестерн - блоттинг, позволяющие определить антитела к различным структурным и неструктурным белкам HCV. Анти-HCV - IgM антитела свидетельствуют о репликативной активности вируса гепатита С. Снижение титров IgM - антител свидетельствует о благоприятном течении заболевания.

Определение РНК HCV методом ПЦР свидетельствует об виремии, которая может быть транзиторной (острый гепатит с последующим выздоровлением), персистирующей (хронические гепатиты) и прерывающейся (повторное выявление).

Специфическая профилактика. В настоящее время проводится работа по созданию вакцин.

Source: studopedia.org

Структурный и неструктурный белок вируса гепатита с

gep.travelel.ru

набор антигенов для раздельного выявления антител к структурным и неструктурным белкам вируса гепатита с - патент РФ 2370776

Изобретение относится к диагностическим средствам медицинского назначения, и касается набора для раздельного выявления антител к структурным и неструктурным белкам вируса гепатита С. Сущность изобретения состоит в том, что с целью оптимизации композиции антигенов в набор включены в качестве антигенов полипептиды, одновременно содержащие эпитопы, характерные для большинства генотипов вируса гепатита С. Использование набора антигенов обеспечивает высокие показатели специфичности. 2 ил.

Рисунки к патенту РФ 2370776

Область техники

Изобретение относится к диагностическим средствам медицинского назначения, применяемым в диагностических лабораториях и банках крови с целью выявления антител к структурным и неструктурным белкам вируса гепатита C, направленного на определение ложноположительных результатов твердофазного иммуноферментного анализа в ходе первичного скрининга на наличие антител к вирусу гепатита C.

Уровень техники

Для раздельного выявления антител к структурным и неструктурным белкам вируса гепатита C (ВГС) применяются в качестве подтверждающих следующие тест-системы: CHIRON RIBA HCV 3.0 (Chiron Corporation, USA), Deciscan anti-HCV (Bio Rad), INNO-LIA HCV Ab III update (Innogenetics).

Все указанные выше тест-системы выполнены в формате иммуноблота. Наиболее близкими аналогами настоящего изобретения являются набор антигенов для определения антител к вирусу гепатита C «ДС-НСV-Антигены», разработанный ООО НПО «Диагностические системы» (патент RU 2262704 C1), и тест-система фирмы Innogenetics. В состав последней тест-системы, согласно Cramp ME Hepatitis C virus (HCV) specific immune responses in anti-HCV positive patients without hepatitis C viraemia. Gut. 1999 Mar; 44 (3): 424-9, в качестве антигенов включены следующие компоненты.

Синтетические пептиды:

- Core: аминокислоты 1-32 и 31-74

- NS4: аминокислоты 1696-1944 и 1916-1944

- NS5: аминокислоты 2263-2318

- Е2: аминокислоты 386-409

Рекомбинантный белок:

- NS3: аминокислоты 1188-1465

Как и в настоящем изобретении, в последовательностях, представляющих белки Core и NS3, представлены иммуногенные детерминанты, являющиеся общими для всех генотипов вируса гепатита C. Однако последовательности, представляющие белок NS4, не содержат иммуногенных детерминант, характерных для генотипов 2 и 5 вируса гепатита C, а последовательность аминокислот, представляющая белок NS5, содержит имуногенные детерминанты, характерные только для генотипа 1. В определенных случаях этот недостаток может существенным образом повлиять на специфичность тест-системы.

Раскрытие изобретения

Целью настоящего изобретения является повышение специфичности подтверждающего теста на основе иммуноблота для выявления антител к структурным и неструктурным белкам вируса гепатита C в сыворотке крови.

Сущность изобретения как технического решения. Важной особенностью ВГС является его генетическая неоднородность. Особенно много субтипов ВГС регистрируется в Африке и Юго-Восточной Азии. Считается, что для клинической практики достаточно разграничивать 5 субтипов ВГС: 1a, 1b, 2a, 2b, 3a (Zein N.N., Persing D.H., 1996). Установлены существенные географические различия в распространении разных генотипов. Так, в Японии, на Тайване, частично в Китае, регистрируются преимущественно генотипы 1b, 2a, 2b. В США преобладает 1a генотип. В Европейских странах преобладает генотип ВГС 1a, в Южной Европе заметно возрастает доля генотипа 1b. В России чаще регистрируется генотип ВГС 1b, далее с убывающей частотой - 3a, 1a, 2a.

Международная практика предусматривает в качестве тестов первичного обследования и скрининга определение антител к ВГС. В тест-системах последнего поколения в качестве антигенов используется смесь рекомбинантных и синтетических фрагментов структурных и неструктурных белков вируса гепатита C (core, NS3, NS4, NS5). Положительные и сомнительные результаты первичного серологического исследования на наличие антител к гепатиту C должны быть проверены другим, более специфичным (подтверждающим) серологическим исследованием или определением вирусной РНК. В основе подтверждающего серологического теста должно лежать раздельное выявление антител к белкам вируса гепатита C.

Таким образом, чувствительный и специфичный подтверждающий тест должен выявлять антитела к разным белкам вируса гепатита C генотипов 1, 2, 3, 4, 5 и 6 в широком диапазоне концентраций и отсеивать ложноположительные результаты первичного скрининга на антитела к ВГС. При положительном результате первичного скрининга методом иммуноферментного анализа, его проводят еще два раза. Если хотя бы в одном из повторных определений результат будет положительным, общий результат считается положительным. Иммуноферментный анализ обеспечивает специфичность не менее 99%. Однако, в группах с низкой частотой носительства, даже при столь высокой специфичности ложноположительных результатов оказывается слишком много. Среди лиц со сниженным иммунитетом (например, у больных на гемодиализе), доля ложноположительных результатов составляет около 15%. Среди лиц с сохранным иммунитетом и частотой носительства менее 10% (доноры, военнослужащие, работники здравоохранения, больные венерологических лечебных учреждений) эта доля еще выше - в среднем 35%. Следовательно, целиком полагаться на первичное определение нельзя. Это не более чем предварительный результат, который необходимо подтвердить более специфичным методом. В качестве подтверждающего метода используют еще один серологический метод - иммуноблоттинг с рекомбинантными и синтетическими вирусными антигенами. Отрицательный результат иммуноблоттинга говорит об отсутствии антител к вирусу гепатита C. Результат первичного определения в этом случае считается ложноположительным, обследованному о нем не сообщают.

Целевое назначение настоящего изобретения (повышение специфичности подтверждающего теста на основе иммуноблота для выявления антител к структурным и неструктурным белкам вируса гепатита C в сыворотке крови) реализовано следующим образом: каждый антиген, используемый в составе тест-системы, а именно рекомбинантные белки, содержащие иммунодоминантные регионы неструктурных белков ВГС NS3, NS4 и NS5 и структурного белка core, представлены аминокислотными последовательностями, содержащими одновременно иммуногенные детерминанты, характерные для различных генотипов вируса гепатита C. Повышение специфичности в этом случае происходит за счет увеличения «удельного веса» иммунодоминантных регионов в антигене.

Выявление участков, содержащих иммуногенные детерминанты, характерные для всех / большинства генотипов вируса гепатита C, было выполнено in silico с применением следующих информационных ресурсов:

1. HCV immunology database: База иммунологических данных по вирусу гепатита C (http://hcv.lanl.gov/content/immuno/immuno-main.html). С помощью этой базы данных были выявлены все возможные эпитопы структурных и неструктурных белков вируса гепатита C.

2. HCV sequence database / HCV BLAST search: База данных сиквенса вируса гепатита C / Программа поиска похожих последовательностей (http://hcv.lanl.gov/content/sequence/BASIC_BLAST/basic_blast.html). С помощью этих базы данных и программы были выявлены эпитопы, общие для большинства генотипов вируса гепатита C, и найдены последовательности с наиболее высокой плотностью таких эпитопов.

Выявленные для каждого антигена последовательности аминокислот с наибольшей плотностью общих для всех (большинства в случае NS5 антигена) генотипов вируса гепатита C представлены на фиг.1. Подчеркнутые участки являются наилучшими антигенами для раздельного выявления антител к структурным и неструктурным белкам вируса гепатита C.

Краткое описание чертежей

На фиг.1А показана аминокислотная последовательность (аминокислоты с 1 по 191) белка core. Подчеркнутые участки содержат иммуногенные детерминанты, представленные во всех генотипах вируса гепатита C.

На фиг.1В показан участок аминокислотной последовательности (аминокислоты с 1192 по 1459) белка NS3. Подчеркнутые участки содержат иммуногенные детерминанты, представленные в 1, 2, 4, 5 и 6 генотипах вируса гепатита C; более крупным, жирным шрифтом выделены иммуногенные участки, представленные во всех генотипах вируса гепатита C.

На фиг.1C показан участок аминокислотной последовательности (аминокислоты с 1676 по 1947) белка NS4. Подчеркнутые участки содержат иммуногенные детерминанты, представленные во всех генотипах вируса гепатита C.

На фиг.1D показан участок аминокислотной последовательности (аминокислоты с 2691 по 2830) белка NS5. Подчеркнутые участки содержат иммуногенные детерминанты, представленные в 1, 2, 3 и 6 генотипах вируса гепатита C.

Осуществление изобретения

Раздельное определение антител к белкам вируса гепатита C с помощью разработанного набора антигенов осуществляется в описанной ниже последовательности.

Для анализа используется нитроцеллюлозная мембрана с адсорбированными в виде отдельных полос антигенами.

Образец (плазма или сыворотка) инкубируется с мембраной. Взаимодействие антител с антигенами проявляется с помощью меченных ферментом антител против IgG человека с последующей детекцией при помощи субстратного комплекса.

Для контроля успешного прохождения реакции на каждую полоску наносится античеловеческий иммуноглобулин (контрольная полоска «Уровень 2+» на фиг.2), для контроля нижней границы положительной реакции на полоску наносится иммуноглобулин человека (контрольная полоска «Уровень 1+» на фиг.2).

Оценка результатов производится визуально по представленной ниже методике. Параллельно с каждой серией исследуемых образцов исследуется отрицательная сыворотка и положительная сыворотка. Исследование считается успешным в случае одновременного выполнения следующих условий:

- полоска, инкубированная с отрицательной сывороткой, должна показать окрашивание только полос контроля прохождения реакции;

- полоска, инкубированная с положительной сывороткой, должна показать четкое окрашивание полос положительного контроля и антигенов. В случае успешного протекания всех контрольных реакций исследуемые образцы сравниваются с контрольными и оцениваются как положительные, отрицательные или неопределенные. Для получения достоверного результата все положительные образцы необходимо протестировать еще раз. В случае неопределенного результата через четыре недели необходимо провести анализ новых образцов крови пациента.

Положительным считается результат, показавший две или больше полоски с интенсивностью окраски +1 и больше.

Неопределенным считается результат, показавший только одну полоску с интенсивностью окрашивания +1 и больше.

ФОРМУЛА ИЗОБРЕТЕНИЯ

Набор для раздельного выявления антител к структурным (core) и неструктурным (NS3, NS4, NS5) белкам вируса гепатита С, включающий комбинацию содержащих иммуноактивные эпитопы структурных и неструктурных антигенов вируса гепатита С, иммобилизованных на поверхности твердофазного носителя, отличающийся тем, что в качестве антигенов включает следующие полипептиды:HCV Core: RRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATHCV Core: RRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVHCV NS 3: KVPAAYAAQGYKVLVLNPSVAATHCV NS 3: ITYSTYGKFLADGGCSGGAYHCV NS 4: NFISGIQYLAGLSTLPGNPAIASLHCV NS 4: EGAVQWMNRLIAFASRGNHVSPTHYHCV NS 5: GYRRCRASGVLT HCV NS 5: RDPTTPLARAAWETAR.

www.freepatent.ru

Неструктурные белки гепатита с - Лечение печени

Антитела к вирусу гепатита C

Гепатит С (HCV) — это опасное вирусное заболевание, которое протекает с поражением тканей печени. По клиническим признакам поставить диагноз невозможно, поскольку они могут быть одинаковыми при разных видах вирусного и незаразного гепатита. Для обнаружения и идентификации вируса больному необходимо сдать кровь на анализ в лабораторию. Там проводятся высокоспецифичные тесты, среди которых — определение антител к гепатиту С в сыворотке крови.

Гепатит С — что это за болезнь?

Возбудитель гепатита С — это вирус, который содержит РНК. Человек может заразиться при попадании его в кровь. Существует несколько путей распространения возбудителя гепатита:

  • при переливании крови от донора, который является источником инфекции;
  • во время процедуры гемодиализа — очистки крови при почечной недостаточности;
  • при инъекционном приеме препаратов, в том числе наркотиков;
  • при беременности от матери к плоду.

Болезнь чаще всего протекает в хронической форме, лечение длительное. При попадании вируса в кровь человек становится источником инфекции и может передавать болезнь окружающим. Перед появлением первых симптомов должен пройти инкубационный период, в течение которого популяция вируса увеличивается. Далее он поражает ткани печени, и развивается выраженная клиническая картина болезни. Сначала пациент чувствует общее недомогание и слабость, затем появляются боли в правом подреберье. На УЗИ печень увеличена, биохимия крови укажет на повышение активности печеночных ферментов. Окончательный диагноз можно поставить только на основании специфических тестов, которые определяют разновидность вируса.

О чем говорит наличие антител к вирусу?

Когда вирус гепатита попадает в организм, иммунная система начинает с ним бороться. Вирусные частицы содержат антигены — белки, которые распознаются иммунной системой. У каждого типа вируса они отличаются, поэтому механизмы иммунного ответа также будут разными. По ним иммунитет человека идентифицирует возбудителя и выделяет ответные соединения — антитела, или иммуноглобулины.

Существует вероятность появления ложноположительного результата на антитела гепатита. Диагноз ставится на основании нескольких анализов одновременно:

  • биохимии крови и УЗИ;
  • ИФА (иммуноферментного анализа) — собственно способа определения антител;
  • ПЦР (полимеразной цепной реакции) — обнаружение РНК вируса, а не собственных антител организма.

Если все результаты указывают на наличие вируса, нужно определить его концентрацию и начинать лечение. Могут также быть и отличия в расшифровке различных тестов. Например, если антитела к гепатиту С положительные, ПЦР отрицательный, вирус может находиться в крови в незначительном количестве. Такая ситуация возникает после выздоровления. Возбудитель удалось удалить из организма, но иммуноглобулины, которые вырабатывались в ответ на него, еще циркулируют в крови.

Методика обнаружения антител в крови

Основной способ проведения такой реакции — это ИФА, или иммуноферментный анализ. Для его проведения необходима венозная кровь, которую берут натощак. За несколько суток до процедуры пациент должен придерживаться диеты, исключить жареные, жирные и мучные продукты из рациона, а также алкоголь. Эту кровь очищают от форменных элементов, которые не нужны для реакции, а только затрудняют ее. Таким образом, тест проводит с сывороткой крови — жидкостью, очищенной от лишних клеток.

В лаборатории уже заранее заготовлены лунки, в которых находится вирусный антиген. В них и добавляют материал для исследования — сыворотку. Кровь здорового человека никак не отреагирует на попадание антигена. Если в ней присутствуют иммуноглобулины, произойдет реакция антиген-антитело. Далее жидкость исследуют при помощи специальных инструментов и определяют ее оптическую плотность. Пациенту придет уведомление, в котором будет указано, обнаружены антитела в исследуемой крови или нет.

Виды антител при гепатите С

В зависимости от стадии болезни можно обнаружить разные типы антител. Некоторые из них вырабатываются сразу после попадания возбудителя в организм и ответственны за острую стадию заболевания. Далее появляются другие иммуноглобулины, которые сохраняются в течение хронического периода и даже при ремиссии. Кроме того, некоторые из них остаются в крови и после полного выздоровления.

Anti-HCV IgG — антитела класса G

Иммуноглобулины класса G обнаруживаются в крови в течение наиболее длительного времени. Они вырабатываются спустя 11—12 недель после инфицирования и сохраняются, пока вирус присутствует в организме. Если в исследуемом материале выявлены такие белки, это может свидетельствовать о хроническом или вялотекущем гепатите С без выраженной симптоматики. Также они активны в период носительства вируса.

Anti-HCV core IgM — антитела класса М к ядерным белкам HCV

Anti-HCV core IgM — это отдельная фракция белков-иммуноглобулинов, которые особо активны в острую фазу заболевания. Их можно обнаружить в крови через 4—6 недель после того, как вирус попадает в кровь больного. Если их концентрация возрастает, это значит, что иммунная система активно борется с инфекцией. При хронизации течения их количество постепенно снижается. Также их уровень повышается во время рецидива, накануне очередного обострения гепатита.

Anti-HCV total — суммарные антитела к гепатиту С (IgG и IgM)

Во врачебной практике чаще всего определяют суммарные антитела к вирусу гепатита С. Это значит, что в результате анализа будут учитываться иммуноглобулины фракций G и M одновременно. Их можно обнаружить спустя месяц после инфицирования больного, как только антитела острой фазы начнут появляться в крови. Примерно через такой же промежуток времени их уровень возрастает из-за накопления антител-иммуноглобулинов класса G. Метод выявления суммарных антител считается универсальным. Он позволяет определить носителя вирусного гепатита, даже если концентрация вируса в крови мала.

Anti-HCV NS — антитела к неструктурным белкам HCV

Перечисленные антитела вырабатываются в ответ на структурные белки вируса гепатита. Кроме них, есть еще несколько маркеров, которые связываются с неструктурными белками. Их также можно обнаружить в крови при диагностике этого заболевания.

  • Anti-NS3 — это антитела, по которым можно определить развитие острой стадии гепатита.
  • Anti-NS4 — это белки, которые накапливаются в крови при длительном хроническом течении. Их количество косвенно указывает на степень поражения печени возбудителем гепатита.
  • Anti-NS5 — белковые соединения, также подтверждающие наличие вирусной РНК в крови. Они особенно активны при хроническом гепатите.

Сроки обнаружения антител

Антитела к возбудителю вирусного гепатита обнаруживаются не одновременно. Начиная с первого месяца болезни, они проявляются в следующем порядке:

  • Анти-HCV суммарные – через 4—6 недель после попадания вируса;
  • Anti-HCV core IgG – спустя 11—12 недель после заражения;
  • Anti-NS3 – самые ранние белки, появляются на ранних этапах гепатита;
  • Anti-NS4 и Anti-NS5 можно обнаружить уже после того, как все остальные маркеры были выявлены.

Носитель антител — это не обязательно пациент с выраженной клинической картиной вирусного гепатита. Наличие этих элементов в крови говорит об активности иммунной системы по отношению к вирусу. Такая ситуация может наблюдаться у больного в периоды ремиссии и даже после лечения гепатита.

Другие способы диагностики вирусного гепатита (ПЦР)

Исследования на гепатит С проводят не только тогда, когда пациент обращается в больницу с первыми симптомами. Такие анализы сдают планово при беременности, поскольку заболевание может передаваться от матери к ребенку и вызывать патологии развития плода. Нужно понимать, что в быту пациенты не могут быть заразны, потому что возбудитель попадает в организм только с кровью либо при половом контакте.

Для комплексной диагностики используется также полимеразная цепная реакция (ПЦР). Для ее проведения также необходима сыворотка венозной крови, а исследования проводятся в лаборатории на специальном оборудовании. Этот метод основан на обнаружении непосредственно вирусной РНК, поэтому положительный результат такой реакции становится основанием для постановки окончательного диагноза на гепатит С.

Существует две разновидности ПЦР:

  • качественная — определяет наличие либо отсутствие вируса в крови;
  • количественная — позволяет выявить концентрацию возбудителя в крови, или вирусную нагрузку.

Количественный метод дорогостоящий. Он используется только в тех случаях, когда больной начинает проходить лечение специфическими препаратами. Перед началом курса определяют концентрацию вируса в крови, а затем отслеживают изменения. Таким образом, можно делать выводы об эффективности конкретных лекарственных средств, которые пациент принимает против гепатита.

Бывают случаи, когда антитела у больного есть, а ПЦР показывает отрицательный результат. Такому явлению есть 2 объяснения. Это может происходить, если по завершении курса лечения в крови осталось незначительное количество вируса, которое не удалось убрать медикаментами. Также может быть, что после выздоровления антитела продолжают циркулировать в кровеносном русле, но возбудителя болезни уже нет. Повторный анализ спустя месяц прояснит ситуацию. Проблема в том, что ПЦР, хоть и является высокочувствительной реакцией, может не определять минимальные концентрации вирусной РНК.

Анализ на антитела при гепатите — расшифровка результатов

Расшифровать результаты анализов и разъяснить их пациенту сможет врач. В первой таблице указаны возможные данные и их интерпретация, если для диагностики проводились общие исследования (тест на суммарные антитела и качественная ПЦР).

Суммарные антитела РНК вируса (результат ПЦР) Интерпретация
Нет Нет Пациент здоров. В любом случае проводится повторный анализ спустя некоторое время.
Есть Есть Такая картина наблюдается после выздоровления, в том числе вследствие лечения противовирусными препаратами.
Есть Есть Инфекция в активной форме, в большинстве случаев в сочетании с выраженной симптоматикой.

Возможно также проведение более полного обследования. К стандартным исследованиям добавляют обнаружение отдельных типов антител. Расшифровать результаты такого анализа самостоятельно может быть трудно, потому что они будут говорить о различных нюансах течения болезни.

Anti-HCV IgM Anti-HCV core IgG Anti-HCV NS IgG РНК HCV Интерпретация
Есть Есть Нет Есть Острая форма заболевания, обычно результат сочетается с выраженной клинической картиной.
Есть Есть Есть Есть Хронический гепатит, латентная стадия, период ремиссии.
Нет Есть Есть Нет Хроническая форма, реактивация перед очередным обострением.
Нет Есть Есть/нет Нет Выздоровление.

Гепатит С — это болезнь, которую можно обнаружить по анализам крови. Более того, различные исследования показывают не только разновидность вируса, но и его количество в кровеносном русле. Такие методы высокоспецифичны. Антитела на определенный вирус, в данном случае вирус гепатита С, не будут обнаруживаться во время диагностики другого заболевания.

Что делать, если антитела обнаружены?

Отрицательный результат говорит о том, что возбудитель гепатита у человека в крови отсутствует, а антитела к нему не выделяются. Если все-таки во время обследования нашли специфические иммуноглобулины, это еще не говорит о точном диагнозе. В таком случае пациенту предлагают сдать кровь повторно во избежание лабораторных погрешностей, особенно если клинические признаки болезни его не беспокоят. Второе исследование крови проводят через 6 месяцев.

Нужно понимать, что антитела могут обнаруживаться в крови еще длительное время после выздоровления, а также в периоды ремиссии. Метод их обнаружения не может быть окончательным для постановки окончательного диагноза. Дополнительно необходимо сдать кровь на ПЦР, чтобы точно определить наличие или отсутствие вирусной РНК у больного. Мало того, перед началом лечения и во время приема противовирусных препаратов нужно отслеживать концентрацию вируса путем проведения количественной ПЦР.

Гепатит С — это опасное заболевание, которое передается с кровью. Анализы на это заболевания проводят не только тогда, когда пациент уже чувствует характерные симптомы. Поскольку оно передается при беременности, женщины в этот период планово сдают кровь на определение антител. Исследования проводят в лаборатории, для них потребуется сыворотка венозной крови и заранее заготовленный антиген. По их результатам можно поставить предварительный диагноз на гепатит С, который затем еще предстоит подтвердить более информативными анализами, в том числе ПЦР.

Какие есть антитела к гепатиту С?

Если диагностика в крови пациента обнаруживает антитела к гепатиту С, у многих людей сразу же начинается паника. Так ли она безосновательна? В одних случаях — да, в других — нет. Их наличие в теле человека указывает на два варианта развития событий. В первом случае нахождение белка, синтезированного лимфоцитами, в крови свидетельствует, что у человека протекает хроническое или острое инфекционное заболевание. Второй вариант развития событий более благоприятный, потому что наличие антител к заболеванию подтверждает: организм успешно с ним борется.

Для того чтобы врачи могли точно определить, что происходит с пациентом, применяется специальная классификация.

В чем разница иммуноглобулинов?

Механизм появления такого белка схематично представить довольно просто. Как только вредоносные бактерии, являющиеся носителями вируса, попадают в организм и начинают проявлять активность, включается его защита — иммунная система. Она реагирует не только на вирусы, но и на инородные частицы, по своим свойствам напоминающие вирусы. Антитела — это белковые структуры. Еще одно их название — иммуноглобулины. На наличие в организме болезнетворных бактерий — носителей болезни — вырабатываются строго определенные группы иммуноглобулинов.

Их обозначают в медицинских документах и специализированной литературе следующим образом:

В ряде источников можно встретить и другой вариант обозначения: IgM и IgG (суммарные антитела). Иммуноглобулины класса М появляются в организме не сразу: с момента заражения человека вирусом должен пройти месяц. Данные противотела быстро увеличиваются в своих количественных показателях. Если в крови пациента их обнаруживают в большом объеме, это указывает, что заболевание находится в стадии обострения.

Борется ли организм с инфекцией?

Повышенное содержание иммуноглобулинов класса М свидетельствует и об активном функционировании иммунной системы. Как только обострение заболевания проходит и состояние здоровья человека начинает улучшаться, анализы покажут: количество антител класса М в крови значительно уменьшилось.

Когда при диагностике обнаружены белковые антитела к вирусу гепатита С класса G, это может быть не всегда положительным результатом лечения. Иммуноглобулин такого типа при инфекционном заболевании появляется значительно позже противотел М. С момента заражения вирусом проходит три месяца, а то и полгода, прежде чем иммуноглобулин класса G начинает вырабатываться иммунной системой. Его наличие указывает, что острая стадия заболевания прошла давно. Но это в том случае, если при повторных анализах врачи будут получать следующие данные: количество белковых структур, являющихся антителами к вирусу формы С класса G, снижается.

Когда показатель иммуноглобулина такого вида не уменьшается, это повод бить тревогу, так как заболевание приняло хроническую форму. Не уменьшающийся показатель наблюдается и тогда, когда человек — носитель недуга.

Существует еще одна категория иммуноглобулинов, которая укажет на то, что организм заражен гепатитом С:

Такие вирусные белки являются неструктурными. Их наличие подтвердит, что пациент — носитель заболевания или есть большая вероятность перехода данного заболевания в хроническую стадию. Высокий уровень иммуноглобулина к белку NS3 в крови означает то, что в организме содержится большое количество вирусов. Положительные результаты свидетельствуют: вирус готов перейти в хроническую стадию. Не меньшую тревогу вызывает высокий уровень антител к белку NS4 в организме. Такая категория белка, синтезированного лимфоцитами на форму С, появляется значительно позже. Для врачей такие показатели важны в первую очередь потому, что помогают определить срок давности заражения.

Высокий показатель NS4 указывает, что произошло поражение тканей печени и нарушено ее функционирование. Белок, синтезированный лимфоцитами на гепатит С против белка NS5, тоже очень важный показатель, ведь он помогает определить специфику протекания и прогрессирования заболевания. Максимальное его количество наблюдается, когда идет обострение болезни, но он же укажет и на готовность заболевания перейти в хроническую форму.

Многие люди считают: раз иммуноглобулин есть в организме, это уже автоматически защищает от болезни. Это далеко не так. Сами по себе антитела неспособны обеспечить защиту от развития инфекции. Снизить риск повторного инфицирования организма гепатитом С они не в силах, но способны бороться с недугом. По изменению их количества есть возможность обнаружить заболевание до того, как оно начнет проявлять свои симптомы. Кроме того, можно отслеживать динамику развития недуга и подбирать максимально эффективные терапевтические меры для борьбы с ним.

Во время и после инфекции

Белок, синтезированный лимфоцитами, вырабатывается организмом при различных видах этого недуга. Количество разновидностей антител к гепатиту В тоже является критерием определения состояния организма и особенностей протекания недуга. Для гепатита С антитела бывают следующих видов:

  • Анти-HBs;
  • Анти-НВс;
  • IgM анти-НВс;
  • Анти-НВе.

Если бы таких иммуноглобулинов не было в организме, иммунная система не могла бы оперативно обнаруживать и уничтожать вирусы. Анти-HBs — данная категория вырабатывается организмом к поверхностному белку вируса. «Анти-НВс» — так в современной медицине обозначают иммуноглобулины к ядерному белку вируса формы В. Наличие антител к гепатиту В, относящихся к категории Анти-НВс, указывает на то, что у человека есть иммунитет к вирусной форме недуга. В крови людей, перенесших болезнь и полностью излечившихся от нее, всегда будет присутствовать вид Анти-НВс.

Поэтому, если их обнаруживают при диагностике, не надо поддаваться панике: наличие данного вида иммуноглобулинов указывает, что иммунная система организма уже имеет опыт борьбы с инфекцией.

IgM анти-НВс — это разновидность антител Анти-НВс. Они входят в состав последних. IgM анти-НВс отличаются тем, что формируются на ранних стадиях борьбы иммунной системы с инфекционным заболеванием. Такой вид антител в большом количестве обнаруживают у людей, когда гепатит В находится в стадии обострения, если у пациента развивается его хроническая острая форма. В большом количестве антитела присутствуют у человека, чья кровь отличается высоким уровнем заразности.

IgM анти-НВс укажут и на низкую эффективность предпринимаемых против заболевания мер. Неэффективное лечение вирусной формы недуга и высокую заразность крови пациента помогут выявить иммуноглобулины к ядерному белку вируса гепатита В Анти-НВе. Их высокий уровень тоже свойственен острым и хроническим видам болезни.

А что говорит современная медицина?

Современная медицина выделяет два класса иммуноглобулинов к заболеванию формы А: M и G. У них есть и второе обозначение, как и у иммуноглобулинов, присутствующих в организме при форме С.

Антитела к гепатиту А класса М имеют свою роль. Она заключается в том, что при наличии их в большом количестве в крови человека, можно говорить о наличии у него острой инфекции. Высокий их уровень к заболеванию формы А класса G указывает на то, что организм перенес уже это заболевание и у него выработался иммунитет. Подобный показатель будет и в том случае, если осуществлена успешно вакцинация против гепатита А. Борьба иммунной системы с недугом начинается с вырабатывания организмом антител к гепатиту А класса М.

Иммуноглобулины другого класса появляются после них и сохраняются в организме пожизненно. Если при анализе обнаружено содержание в крови значительного количества антител к гепатиту А класса G и человек благополучно до этого перенес инфекцию или прошел вакцинацию, это абсолютно нормально, при условии, что иммуноглобулинов класса М у него нет.

Для определения наличия иммуноглобулина необходим анализ крови. Забор материала на исследование осуществляется в вакуумную пробирку. Подготовка к данному виду диагностики удобна тем, что не требует от пациента специальной подготовки.

Исследование антител дает возможность четко определить стадию заболевания и подобрать оптимальные методы терапии.

Направление на анализ человек получает не только при наличии у него заболевания. Диагностика крови на антитела необходима и в качестве профилактической меры, чтобы выявить наличие иммунитета к тому или иному виду болезни. Точную расшифровку результата диагностики могут дать только медицинские специалисты. Если полученные в ходе исследования данные вызывают сомнения, назначается повторный анализ крови.

gepatoz.lechenie-pechen.ru

Структурные и неструктурные белки вируса гепатита с

Патогенез и осложнения гепатита С

Возбудителем гепатита С у людей разного возраста является одноименный вирус. Патогенез гепатита С все еще изучен недостаточно хорошо, но некоторые наработки ученых, касающиеся поражения печени человека, все же имеются. Стоит отметить, что гепатит С был открыт сравнительно недавно — в конце 90-х, хотя другие виды этого заболевания, в том числе А и В, известны медицинской науке более 50 лет.

Откуда появился новый и более опасный штамм, который в дальнейшем получил название гепатит С, в настоящее время неизвестно, но нужно учитывать, что этот вирус еще не сформировался полностью и имеет высокую степень мутации РНК, что обеспечивает ему значительную защиту как от иммунной системы, так и от лекарственных средств.

Основные особенности вируса гепатита С

Возбудитель гепатита С относится к семейству Flaviviridae. Длительное время считалось, что этот вирус является единственным представителем подсемейства, но сравнительно недавно был выявлен другой тип вируса С, который, как правило, поражает собак. Вирус имеет простую структуру, покрыт липидной оболочкой, диаметр тела вируса составляет 50-55 нм.

В составе вируса присутствует нуклеокапсид, содержащий однонитную линейную РНК. Последние исследования выявили, что генотип вируса включает в себя примерно 9600 нуклеотидов. В геноме вируса существует 2 области, в одной из которой преобразуются структурные белки, а в другой — неструктурные. Неструктурные белки обладают ферментной способностью и являются важным компонентом для репликации при попадании в здоровую клетку носителя.

Изучение вируса и белков, которые им продуцируются, очень важная отрасль в медицине, которая позволяет создавать более эффективные лекарственные препараты, направленные на лечение и поддержку организма.

Характерной особенностью вируса является высокая способность к мутации, поэтому в организме людей, страдающих этим заболеванием, обнаруживается огромное количество мутантных штаммов. Предполагается, что генетическое разнообразие мутировавших вирусных элементов, которые получили название квазивидов, является механизма вируса, способствующим его защите от иммунной системы человека.

В настоящее время выделяются 6 основных генотипов и более 100 различных субтипов вируса гепатита С. Генотип не слишком влияет на исход болезни и на тяжесть ее течения, но все же позволяет предсказать, насколько будет эффективной противовирусная терапия. Самыми сложными в плане лечения являются 1 и 4 генотипы гепатита С, так как они почти не поддаются воздействию противовирусных препаратов.

Основные черты развития гепатита С

Патогенез гепатита С в настоящее время еще не полностью изучен и многие моменты остаются для ученых настоящей загадкой. Дело в том, что, к примеру, патогенез гепатита В имеет четкие грани развития, которые можно легко проследить в лабораторных условиях. Однако с гепатитом С все совсем иначе, так как состав его РНК постоянно претерпевает мутацию и квазивиды циркулируют в организме, но все же существуют и известные моменты патогенеза, которые во многом могут прояснить природу поражения. Выделяются несколько этапов размножения вируса в организме:

  • проникновение в организм;
  • поражение гепатоцита;
  • репликация;
  • синтез белков;
  • упаковка РНК;
  • выведение вируса из клетки печени.

При гепатите В в патогенезе имеется приблизительно похожая структура. Итак, вирус гепатита С попадает в организм человека в основном через кровь, к примеру, при совместном использовании маникюрных принадлежностей, переливании крови и других процедурах. Удивительно, но гепатиты А и В вполне могут передаваться не только через кровь, но и через половые акты.

Основными клетками, которые поражаются вирусом, являются гепатоциты. Гепатоциты — это клетки печени, которые имеют структуру, отличную от других органов. Именно в гепатоцитах происходит размножение вируса и дублирование его РНК, причем в ряде случаев патогенная РНК появляется с явными мутациями.

Во многом отдельные элементы вируса имеют схожие черты с клетками печени, вследствие чего патогенная РНК может оказывать прямое деструктивное воздействие на здоровые клетки печени, меняя их свойства и состав.

Кроме того, из-за наличия множества разных элементов РНК и квазивидов вируса гепатита С наблюдается появление множественных антигенных вариантов, что способствует затруднению реализации адекватного иммунного ответа.

Частички клеток вируса со временем начинают проникать в клетки макрофагальной системы организмы, являющейся частью иммунитета, что провоцирует появление реакции элиминации на вирус. Это означает, что иммунная система перестает реагировать на патогенный вирус. Этот механизм влияния патогенной РНК на иммунитет также может спровоцировать аутоиммунную реакцию организма. В этом случае иммунная система будет нападать на здоровые клетки печени. Существует теория, что вирус гепатита С может мутагенно воздействовать на макрофаги, которые в дальнейшем запускают аутоиммунную реакцию.

Возможные осложнения течения гепатита С

Гепатит С — это очень коварное заболевание, которое может долгое время протекать почти бессимптомно. Многим может показаться, что такой вариант течения болезни даже более приемлем, ведь больные чувствуют себя хорошо, но это не совсем так. Для того чтобы клетки печени оставались целыми длительный срок, очень важно придерживаться правильной диеты, не принимать алкоголя и тщательно следить за своим здоровьем.

Примерно за 15-20 лет течения болезни гепатит С полностью разрушает печень и становится причиной появления цирроза.

Тяжелая печеночная недостаточность ведет к летальному исходу, поэтому средняя продолжительность жизни людей, страдающих гепатитом С, не превышает 17-20 лет. Поражение печени гепатитом С способствует развитию печеночно-клеточного рака, что тоже может существенно снизить качество и продолжительность жизни больного.

1-popecheni.ru